General Information

  • ID:  hor000747
  • Uniprot ID:  P04404
  • Protein name:  Parastatin
  • Gene name:  CHGA
  • Organism:  Sus scrofa (Pig)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0002551 mast cell chemotaxis; GO:0033604 negative regulation of catecholamine secretion; GO:0042742 defense response to bacterium; GO:0043303 mast cell degranulation; GO:0045576 mast cell activation; GO:0046676 negative regulation of insulin secretion; GO:0050829 defense response to Gram-negative bacterium; GO:0050830 defense response to Gram-positive bacterium; GO:0086030 adenylate cyclase-activating adrenergic receptor signaling pathway involved in cardiac muscle relaxation; GO:2000707 positive regulation of dense core granule biogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030133 transport vesicle; GO:0030141 secretory granule; GO:0031410 cytoplasmic vesicle; GO:0042583 chromaffin granule; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  LSFRAPAYGFRGPGLQLRRGWRPSSREDSVEAGLPLQVRXYLEEKKEEEGSANRRPEDQELESLSAIEAELEK
  • Length:  73
  • Propeptide:  SAAALALLLCAGQVIALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERSHQQKKQSSYEDELSEVLEKQNDQAELKEGTEEASSKEAAEKRGDSKEVEKNDEDADGAKPQASLEPPXXXEAEDQTPGEEEAASTHPLASLPSKKRPGAQAEEDHEGPSQGPVDREKGPSAEQGPQAEREEEEEAEAGEKAVPEEEGPRSEAFDSHPSLGYKEMQRGWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRGGKRGEPAQEEEERLSEEWENAKRWSKMDRLAKELTAEKRLQGEEEEEEEEEDPDRSMKLSFRAPAYGFRGPGLQLRRGWRPSSREDSVEAGLPLQVRXYLEEKKEEEGSANRRPEDQELESLSAIEAELEKVAPQLQSLRRG
  • Signal peptide:  SAAALALLLCAGQVIA
  • Modification:  T25 Phosphoserine;T29 Phosphoserine;T51 Phosphoserine;T65 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits low calcium-stimulated parathyroid cell secretion.
  • Mechanism:  Binds calcium with a low-affinity.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000747_AF2.pdbhor000747_ESM.pdb

Physical Information

Mass: 959246 Formula: C357H567N107O115
Absent amino acids: CHMT Common amino acids: E
pI: 4.69 Basic residues: 12
Polar residues: 16 Hydrophobic residues: 21
Hydrophobicity: -102.33 Boman Index: -22217
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 69.59
Instability Index: 9011.64 Extinction Coefficient cystines: 8480
Absorbance 280nm: 117.78

Literature

  • PubMed ID:  8344192
  • Title:  Parastatin (porcine chromogranin A347-419), a novel chromogranin A-derived peptide, inhibits parathyroid cell secretion.